Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence AAVLPQLCKVEMF----------DKNARFVGMARGNWDKDFVIKGHTIKCNTRCETK--------DVVL--PKNWSVKG 1P9K Chain:A ((1-79)) GSMIHRMSNMATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAVETRKRCKIVAGQTVSFAGHSVQVVA

General information: TITO was launched using: RESULT: Template: 1P9K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 141 8664 61.44 146.84 target 2D structure prediction score : 0.36 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : 61.44 2D Compatibility (Sec. Struct. Predict.) : 0.36 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.311

(partial model without unconserved sides chains): PDB file : Tito_1P9K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1p9k-query.scw PDB file : Tito_Scwrl_1P9K.pdb: