Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---PIPRIIGPCEVKVLKAG--VSQHLAYFKMGRETTKTFFVPVPGGSTYLFELRTTYDCTATILRWTMPRDYG------------------- 2X5H Chain:A ((1-92)) GMASLKEIIDELGKQAKEQNKIASRIMKIKGIKRIVVQLNAVPQDGKIRYSMTIHSQNNFRKQIGI-TPQDAEDLKLIAEFLEKYSDFLNEYV

General information: TITO was launched using: RESULT: Template: 2X5H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 195 8709 44.66 128.07 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : 44.66 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.124

(partial model without unconserved sides chains): PDB file : Tito_2X5H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2x5h-query.scw PDB file : Tito_Scwrl_2X5H.pdb: