Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --DCFIGLYEKGGRNPNHIAGT--EADESGTFEVLHENYKIRVKIFKC----VKQHVYDSTPSGTEIRVI 2M8G Chain:X ((428-497)) TSSELPELLRKRERKTGDLPKFIEETEKKRIIEALEKTGYVKSRAAKLLGYTLRQLDYRIKKYGIELKKF

General information: TITO was launched using: RESULT: Template: 2M8G.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 114 -311 -2.73 -5.02 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain X : 0.70 3D Compatibility (PKB) : -2.73 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.138

(partial model without unconserved sides chains): PDB file : Tito_2M8G.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2m8g-query.scw PDB file : Tito_Scwrl_2M8G.pdb: