Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence PIPRIIGPCEVKVLKAGVSQ----HLAYFKMGRETTKTFFVPVP--GGSTYLFELR-TTYDCTATILRWTMPRDYG------- 1BVZ Chain:A ((503-585)) GNVRSWHADKQANLYAFVRTVQDQHVGVVLNNRGEKQTVLLQVPESGGKTWLDCLTGEEVHGKQGQLKLTLRPYQGMILWNGR

General information: TITO was launched using: RESULT: Template: 1BVZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 242 5400 22.31 78.26 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : 22.31 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.138

(partial model without unconserved sides chains): PDB file : Tito_1BVZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1bvz-query.scw PDB file : Tito_Scwrl_1BVZ.pdb: