Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence CTYSVYDSIGKMVVEDKDLPT---------NRRDYYTIGKKK------YTFYFKENCDFDYSKPPLPRCWHVSGI 1I50 Chain:I ((50-122)) TNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS--

General information: TITO was launched using: RESULT: Template: 1I50.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain I - contact count / total energy / energy per contact / energy per residue : 165 3448 20.90 59.45 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain I : 0.69 3D Compatibility (PKB) : 20.90 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.360

(partial model without unconserved sides chains): PDB file : Tito_1I50.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1i50-query.scw PDB file : Tito_Scwrl_1I50.pdb: