Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----RFCVYYDGHLPATRVLLMYVRIG------TTATITARGHEFEVEAKDQNCKVILTNGKQA 1F2L Chain:A ((5-68)) VTKCNITCSKMTSKIPVAL-LIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQ

General information: TITO was launched using: RESULT: Template: 1F2L.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 163 -560 -3.43 -10.56 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -3.43 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.204

(partial model without unconserved sides chains): PDB file : Tito_1F2L.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1f2l-query.scw PDB file : Tito_Scwrl_1F2L.pdb: