Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------SPGTLAEDADS-PARPCKVTISMAVSPGGYFRQI-YGEGLTTR--GGRVAIENFKCTVDETC---NNPSCPDVP-------PTWQVTSYD-- 3FC7 Chain:A ((142-241)) SDSPDGIVHLTTNGTILSVNPSMAGRLGADPDTL---VGQQLSAVMDSEAANQRLEAGKSAVENGTATRSEDAVGGRHYHNQYIPVDSHRKSDTFQLVSRDIT

General information: TITO was launched using: RESULT: Template: 3FC7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 238 7715 32.41 105.68 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : 32.41 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.043

(partial model without unconserved sides chains): PDB file : Tito_3FC7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3fc7-query.scw PDB file : Tito_Scwrl_3FC7.pdb: