Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --QDL------RRPLLCDV---YIEYPSGQVFDQALGHDIVPAGETAEISGFKCKTVRGTCV-- 1TOC Chain:R ((57-119)) HSSEMHSSCLGDPPTSCAEGTDITYYDSDSKTCKVLAAS-CPSGENTFESEVECQVACGAPIEG

General information: TITO was launched using: RESULT: Template: 1TOC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain R - contact count / total energy / energy per contact / energy per residue : 164 1092 6.66 21.84 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain R : 0.67 3D Compatibility (PKB) : 6.66 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.205

(partial model without unconserved sides chains): PDB file : Tito_1TOC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1toc-query.scw PDB file : Tito_Scwrl_1TOC.pdb: