Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----CDFIIKQNGTQITSGNIWAGATASFLVSGKWAVVSATSECKLSLSGLPNNESYTILP
5LOP Chain:C ((3-64))NFKGYQIEIELKDGKRITGTLKQVSPKSLTLTDAVFQDGGVSPVFKIKADKLYDLKVLKLPP


General information:
TITO was launched using:
RESULT:

Template: 5LOP.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 212 13253 62.51 232.51
target 2D structure prediction score : 0.68
Monomeric hydrophicity matching model chain C : 0.62

3D Compatibility (PKB) : 62.51
2D Compatibility (Sec. Struct. Predict.) : 0.68
1D Compatibility (Hydrophobicity) : 0.62
QMean score : 0.249

(partial model without unconserved sides chains):
PDB file : Tito_5LOP.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5lop-query.scw
PDB file : Tito_Scwrl_5LOP.pdb: