Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------AAAFGPLTRIDKPFTQYRITYTAPNKKPVVNKLGYG-NTAKLSVDGITYTAVADA----KCKFVI---------VGSPWPAGHFTVGQV 2WGO Chain:A ((-1-96)) SLILDGDLLKDKLKLPVIDNLFGKELLDKFQDDIKDKYGVDTKDLKILKTSEDKRFYYVSVDAGDGEKCKFKIRKDVDVPKMVGRKCRKDDDDDDGY

General information: TITO was launched using: RESULT: Template: 2WGO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 284 3201 11.27 42.68 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : 11.27 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.103

(partial model without unconserved sides chains): PDB file : Tito_2WGO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2wgo-query.scw PDB file : Tito_Scwrl_2WGO.pdb: