Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -AQKICHFTILKMYKNTWTFVRKDSAPADQTTTIEGIKVFFSKDCIPQHDY- 1YTF Chain:C ((34-79)) ENLMLCLYDKVTRTKARWKCSLKDG-----VVTINRNDYTFQK-AQVEAEWV

General information: TITO was launched using: RESULT: Template: 1YTF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 120 -3691 -30.76 -83.89 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain C : 0.64 3D Compatibility (PKB) : -30.76 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.120

(partial model without unconserved sides chains): PDB file : Tito_1YTF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1ytf-query.scw PDB file : Tito_Scwrl_1YTF.pdb: