Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------------IFKKPVPTSCKLALTN-GNKREVDAKLLPPSG--------TTILSDTSGAGIFTAKVNS---------KCEFT--SVSPALPTGFNIEGSV 3BOV Chain:A ((2-105)) LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASY

General information: TITO was launched using: RESULT: Template: 3BOV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 195 14984 76.84 211.04 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 76.84 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.495

(partial model without unconserved sides chains): PDB file : Tito_3BOV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3bov-query.scw PDB file : Tito_Scwrl_3BOV.pdb: