Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------------------PIPRIIGPCEVKVLKAGVSQHLAYFKMGRETTKTFFVPVPGGSTYLFELRTTY---DCTATILRWTMPRDYG--- 1EGJ Chain:A ((1-101)) IQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTES

General information: TITO was launched using: RESULT: Template: 1EGJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 165 415 2.51 6.01 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : 2.51 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.178

(partial model without unconserved sides chains): PDB file : Tito_1EGJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1egj-query.scw PDB file : Tito_Scwrl_1EGJ.pdb: