Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------------------------------------------------------------------------------------------------------------------------------------------SNDKCFVSSYKFTPDGRKVIEASQAAPGDGPITFTSTRDNFHMTIQIDANCAPRN--PDDIQKELP-------------------------- 2E3N Chain:A ((22-255)) HRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSGNQ----------EISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF

General information: TITO was launched using: RESULT: Template: 2E3N.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 76 3426 45.07 63.44 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : 45.07 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.109

(partial model without unconserved sides chains): PDB file : Tito_2E3N.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2e3n-query.scw PDB file : Tito_Scwrl_2E3N.pdb: