Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceAGISNTNPPGGAPRPRQQCFLSAD-LGPDVMGQPTLLEATPFVNDMFDFHGYRCQMGKDCSHVRCRGFPAAFKMTAR-----------------------------------------------------
5IJ7 Chain:S ((28-154))NRLYFHSDTCLPLRPQEMEVDDEDEKDPEWLREKTITQIEEFSDV---NEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKL


General information:
TITO was launched using:
RESULT:

Template: 5IJ7.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain S - contact count / total energy / energy per contact / energy per residue : 108 6372 59.00 87.28
target 2D structure prediction score : 0.38
Monomeric hydrophicity matching model chain S : 0.57

3D Compatibility (PKB) : 59.00
2D Compatibility (Sec. Struct. Predict.) : 0.38
1D Compatibility (Hydrophobicity) : 0.57
QMean score : 0.078

(partial model without unconserved sides chains):
PDB file : Tito_5IJ7.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5ij7-query.scw
PDB file : Tito_Scwrl_5IJ7.pdb: