Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---HF----CEVSVSYENANKQKITTATKYVVP----------PGSVDIAVGSQMYAVTVDETCKRT---DSISIPGR--FKIDTQGK---------- 5J4F Chain:A ((22-119)) EVVHFLEGVCFEKLHIEVLNENSSHKEIRICMPKGAVMDKHKAPGAISVQVLEGKIVFEVGDEKIEMPKGALISLEAQVLHRLDALENSVIRLSLSKK

General information: TITO was launched using: RESULT: Template: 5J4F.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 153 11257 73.58 170.56 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 73.58 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.387

(partial model without unconserved sides chains): PDB file : Tito_5J4F.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5j4f-query.scw PDB file : Tito_Scwrl_5J4F.pdb: