Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----DGCPVDIMINNQRYHWTNK------PRNSSFEIVVQGQTVATVHLDEDCNVRL------------------- 1RL6 Chain:A ((7-81)) PIEIPAG--VTVTVNGNTVTVKGPKGELTRTFHPDMTITVEGNVITVTRPSDEKHHRALHGTTRSLLANMVEGVSKG

General information: TITO was launched using: RESULT: Template: 1RL6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 135 14130 104.66 313.99 target 2D structure prediction score : 0.89 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 104.66 2D Compatibility (Sec. Struct. Predict.) : 0.89 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.578

(partial model without unconserved sides chains): PDB file : Tito_1RL6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1rl6-query.scw PDB file : Tito_Scwrl_1RL6.pdb: