Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence NFCAYYIKTLEGWE-LVGWVKIGGQDELTWKGDSIGVKAEDTDCKVVLVNGQ 5JHJ Chain:A ((37-86)) --CVYYDGHLPATRVLLMYVRIGNTATITARGHEFEVEAKDQNCKVILTNGK

General information: TITO was launched using: RESULT: Template: 5JHJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 156 5510 35.32 112.44 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.80 3D Compatibility (PKB) : 35.32 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.329

(partial model without unconserved sides chains): PDB file : Tito_5JHJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5jhj-query.scw PDB file : Tito_Scwrl_5JHJ.pdb: