Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ISSPESLSDEEFEKFCCVYIVNLGKP--DQREWPVLTGKEVWFEHKRKKYDVMAFDSCNLVWGRRGEPKGVTF 6BQ4 Chain:A ((134-188)) --------DEEVVEFCKSYLVVNKEAFHDSRLEVVINDAKAELEGKEEKYDVIVGDLADPIEG----------

General information: TITO was launched using: RESULT: Template: 6BQ4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 58 5803 100.05 109.49 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : 100.05 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.168

(partial model without unconserved sides chains): PDB file : Tito_6BQ4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-6bq4-query.scw PDB file : Tito_Scwrl_6BQ4.pdb: