Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence GCSASILKYDANGGQETYYGSALPANGSIAFQPTEFGTEVVISVDANCNPTNTDDVKKSVPKGWGLH 2OCC Chain:K ((6-54)) -----------APDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVG-----RVTPKEWR--

General information: TITO was launched using: RESULT: Template: 2OCC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain K - contact count / total energy / energy per contact / energy per residue : 22 -619 -28.14 -12.63 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain K : 0.63 3D Compatibility (PKB) : -28.14 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.167

(partial model without unconserved sides chains): PDB file : Tito_2OCC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2occ-query.scw PDB file : Tito_Scwrl_2OCC.pdb: