Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --HFCEVSVSYENANKQKITTATKYVVPPGSVDIAVGSQMY-AVT--VDETCKRTDSI--------SIPGRFKIDTQGK 4ESN Chain:A ((16-93)) YFQGAVVTVDGEVYGTYSLAKDQTIEIQDGNRLRIQNGQAKMEWADCPDQLCVHQKAISRTGESIICLPNQVVVSVQG-

General information: TITO was launched using: RESULT: Template: 4ESN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 224 -5449 -24.32 -83.82 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -24.32 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.220

(partial model without unconserved sides chains): PDB file : Tito_4ESN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4esn-query.scw PDB file : Tito_Scwrl_4ESN.pdb: