Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------------------------------KCNISILKDGKYFTQ-------KQEIAGWTVKFHDLD----GNYVGKCKNAHTYACTYVTCEDLAPGYSPG 1IE5 Chain:A ((1-107)) GKDIQVIVNVPPSVRARQSTMNATANLSQSVTLACDADGFPEPTMTWTKDGEPIEQEDNEEKYSFNYDGSELIIKKVDKSDEAEYICIAENKAGEQDATIHLKVFAK-----

General information: TITO was launched using: RESULT: Template: 1IE5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 93 4609 49.55 83.79 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : 49.55 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.382

(partial model without unconserved sides chains): PDB file : Tito_1IE5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1ie5-query.scw PDB file : Tito_Scwrl_1IE5.pdb: