Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------------------RFCVYYDGHLPATRVLLMYVRI--GTTA-----TITARGHEFEVEAKDQNCKVILTNGKQA--------------------------------------------- 1AYO Chain:A ((1-130)) EFPFALEVQTLPQTCDGPKAHTSFQISLSVSYIGSRPASNMAIVDVKMVSGFIPLKPTVKMLERSNVSRTEVSNN--HVLIYLDKVTNETLTLTFTVLQDIPVRDLKPAIVKVYDYYETDEFAVAEYSAPCS

General information: TITO was launched using: RESULT: Template: 1AYO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 90 -6778 -75.31 -130.34 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -75.31 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.258

(partial model without unconserved sides chains): PDB file : Tito_1AYO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1ayo-query.scw PDB file : Tito_Scwrl_1AYO.pdb: