Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------QVPEATQMYAPGYDLNK---APCRIVIY--KPTNP---------IGGTGEEYFMGNVAPGGVARFDGYICKASKDCLRPTCFNMPFGFRYFGRHM
4NOF Chain:A ((4-114))GGLPSDTHVYTKDIGRNVTIECPFKRENAPSKKSLCKKTNQSCELVIDSTEKVNPSYIGRAKLFMKGTDLTVFYVNISHLTHNDAGLYICQAGEG---PSADKKNVDLQVLAPE-


General information:
TITO was launched using:
RESULT:

Template: 4NOF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 213 3829 17.97 49.72
target 2D structure prediction score : 0.49
Monomeric hydrophicity matching model chain A : 0.66

3D Compatibility (PKB) : 17.97
2D Compatibility (Sec. Struct. Predict.) : 0.49
1D Compatibility (Hydrophobicity) : 0.66
QMean score : -0.049

(partial model without unconserved sides chains):
PDB file : Tito_4NOF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4nof-query.scw
PDB file : Tito_Scwrl_4NOF.pdb: