Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-NFCAYYIKTLEGWELVGW----VKIGGQDELTWKGDSIGVKAEDTDCKVVLVNGQ----------
1F1S Chain:A ((920-984))SKQQVIYDKNSQTWAVIKHDNQESLINNQFKMN-KAGLYLVQKVGNDYQNVYYQPQTMTKTDQLAI


General information:
TITO was launched using:
RESULT:

Template: 1F1S.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 156 3163 20.28 63.26
target 2D structure prediction score : 0.50
Monomeric hydrophicity matching model chain A : 0.67

3D Compatibility (PKB) : 20.28
2D Compatibility (Sec. Struct. Predict.) : 0.50
1D Compatibility (Hydrophobicity) : 0.67
QMean score : 0.485

(partial model without unconserved sides chains):
PDB file : Tito_1F1S.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1f1s-query.scw
PDB file : Tito_Scwrl_1F1S.pdb: