Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence GECIVKLHDPNGKVVSWFIALAGKREVKKEAAF-SWSCSTNSETCEAEIPLCIVPKNFKPVGEH 1GPS Chain:? ((1-47)) KICRRRSAGFKGPCMSN-KNCA---QVCQQEGWGGGNCDGPFRRC-----KCIRQC--------

General information: TITO was launched using: RESULT: Template: 1GPS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 185 -8385 -45.32 -182.28 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -45.32 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.340

(partial model without unconserved sides chains): PDB file : Tito_1GPS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1gps-query.scw PDB file : Tito_Scwrl_1GPS.pdb: