Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-NCEI-TILQGESRIGFVNVPSSGKVRENIRNWWYTISCDEDCNPKISGF----------------------------------
3BY7 Chain:A ((2-86))KNIKIMRLVTGEDIIGNISESQG---LITIKKAFVIIPM-QPVQLVLSPWQPYTDDKEIVIDDSKVITITSPKDDIIKSYESHT


General information:
TITO was launched using:
RESULT:

Template: 3BY7.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 121 -11193 -92.50 -254.39
target 2D structure prediction score : 0.39
Monomeric hydrophicity matching model chain A : 0.64

3D Compatibility (PKB) : -92.50
2D Compatibility (Sec. Struct. Predict.) : 0.39
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.359

(partial model without unconserved sides chains):
PDB file : Tito_3BY7.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3by7-query.scw
PDB file : Tito_Scwrl_3BY7.pdb: