Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------------------KCNISILKDGK------YFTQ-KQEIAGW----------TVKFHDLDGNYVGKC----------KNAHTYAC---TYV-TCEDLAPGYSPG----- 2PIA Chain:? ((104-223)) EFPLDKRAKSFILVAGGIGITPMLSMAR---QLRAEGLRSFRLYYLTRDPEGTAFFDELTSDEWRSDVKIHHDHGDPTKAFDFWSVFEKSKPAQHVYCCGPQALMDTVRDMTGHWPSGTVHFE

General information: TITO was launched using: RESULT: Template: 2PIA.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 159 -863 -5.43 -15.14 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -5.43 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.185

(partial model without unconserved sides chains): PDB file : Tito_2PIA.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2pia-query.scw PDB file : Tito_Scwrl_2PIA.pdb: