Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence DCFIGLYEKGGRNPNHIAGTEADES-GTFEVLHENYKIRVKIFKCVKQHVYDSTPSGTEIRVI-- 1PC0 Chain:A ((17-77)) GLMVEVVESPNHSEVGIKGEVVDETQNTLKIMTEKGLKVVA-KRGRTFRVWY---KGKIMRIKGD

General information: TITO was launched using: RESULT: Template: 1PC0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 245 854 3.48 14.72 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : 3.48 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.316

(partial model without unconserved sides chains): PDB file : Tito_1PC0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1pc0-query.scw PDB file : Tito_Scwrl_1PC0.pdb: