Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceGWCKVKVLYRYNSKEAQAT-----YAEIDKETHWNLDGFPIVIKPDG-DCTVELVSGWVDHKTYFFKGE
4ZDT Chain:B ((1-69))GSMIVTQTHRAISQVVKQAKDNSVWIKILTYSAIDVEEFQLWLKRKNLNVSLDLIKSWCDKYGVLMKGS


General information:
TITO was launched using:
RESULT:

Template: 4ZDT.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 168 2698 16.06 42.83
target 2D structure prediction score : 0.41
Monomeric hydrophicity matching model chain B : 0.72

3D Compatibility (PKB) : 16.06
2D Compatibility (Sec. Struct. Predict.) : 0.41
1D Compatibility (Hydrophobicity) : 0.72
QMean score : 0.284

(partial model without unconserved sides chains):
PDB file : Tito_4ZDT.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4zdt-query.scw
PDB file : Tito_Scwrl_4ZDT.pdb: