Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence AAVLPQLCKVEMFDKNARFVGMARGNWDKDFVIKGHTIKCNTRCETKDVVL-PKNWSVKG-- 1C0M Chain:A ((217-269)) --VLTEGPPVKIRIET----GEWEKGWNVLVWGRGYAAVKNR--DTDKVIWVPSRK-VKPDI

General information: TITO was launched using: RESULT: Template: 1C0M.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 175 -466 -2.66 -9.31 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -2.66 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.169

(partial model without unconserved sides chains): PDB file : Tito_1C0M.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1c0m-query.scw PDB file : Tito_Scwrl_1C0M.pdb: