Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---PPSATEKCAYTIYRVASKNG-----LKALVREGDYIAYKNWDQEIHGVQVHFDGECNPKYKSDVYVF 1E68 Chain:A ((1-70)) MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW

General information: TITO was launched using: RESULT: Template: 1E68.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 215 5068 23.57 81.74 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : 23.57 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.143

(partial model without unconserved sides chains): PDB file : Tito_1E68.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1e68-query.scw PDB file : Tito_Scwrl_1E68.pdb: