Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------GLKDCQVSLTATSEARRSFW---DTQYA--DYNDDVEISAGRHKFVIHVEQGCGGSKVSGTIP-PHHL
1F00 Chain:I ((753-841))TLTIDDGNIEIVGTGVKGKLPTVWLQYGQVNLKASGGNGKYTWRSANPAIASVDASSGQVTLKEKGTTTISVISS-DNQTATYTIATPNS-


General information:
TITO was launched using:
RESULT:

Template: 1F00.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain I - contact count / total energy / energy per contact / energy per residue : 164 7562 46.11 126.03
target 2D structure prediction score : 0.60
Monomeric hydrophicity matching model chain I : 0.60

3D Compatibility (PKB) : 46.11
2D Compatibility (Sec. Struct. Predict.) : 0.60
1D Compatibility (Hydrophobicity) : 0.60
QMean score : 0.416

(partial model without unconserved sides chains):
PDB file : Tito_1F00.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1f00-query.scw
PDB file : Tito_Scwrl_1F00.pdb: