Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----KRCDVGIYNSDG--TGPRAYKNID-----IPASCSQW------------DFDFEYGGVTYTVRLHYEGCRTEIIGRP--QLPSHLIIRG------- 1SE9 Chain:A ((1-101)) EAEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPREKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEK

General information: TITO was launched using: RESULT: Template: 1SE9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 165 8669 52.54 127.48 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : 52.54 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.69 QMean score : -0.021

(partial model without unconserved sides chains): PDB file : Tito_1SE9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1se9-query.scw PDB file : Tito_Scwrl_1SE9.pdb: