Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence QDLRRPLLCDVYIEYPSGQVFDQALGHDIVPAGETAEISGFKCKTVRGTCV-- 2KGH Chain:A ((1-39)) -IFECVFSCDI-----------KKEGKPCKPKGEKKCTGGWRCKI--KLCLKI

General information: TITO was launched using: RESULT: Template: 2KGH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 130 -8780 -67.53 -237.28 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -67.53 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.332

(partial model without unconserved sides chains): PDB file : Tito_2KGH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2kgh-query.scw PDB file : Tito_Scwrl_2KGH.pdb: