Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence IFKKPVPTSCKLALTNGNKREVDAKLLPPSGTTILSD-------TSGAGIFTAKVNSKCEFTSVS----PALPTGFNIEGSV----------------- 5DHD Chain:A ((3-100)) -FVKPGSLSVKVTDWGNTEYDVTLNLGGTYDWVVKVKLKDGSSVSSFWSANKAEEGGYVVFTPVSWNRGPTATFGFIATGSESVEAIYLYVDGQLWDAW

General information: TITO was launched using: RESULT: Template: 5DHD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 197 268 1.36 3.82 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : 1.36 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.233

(partial model without unconserved sides chains): PDB file : Tito_5DHD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5dhd-query.scw PDB file : Tito_Scwrl_5DHD.pdb: