Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------------GADTRLVPGCL-VKLYRP---PKYIGCFDRSILVGAKCIPVQTTWKIKGHDISVWNGCSTVKGINL--PKGWFVKGE----------------------------------------------------------------------
4QMF Chain:B ((7-181))ESSFMTLFPKYRESYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDDM----ACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHIKELMIKRELAKR


General information:
TITO was launched using:
RESULT:

Template: 4QMF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 222 2321 10.45 34.64
target 2D structure prediction score : 0.27
Monomeric hydrophicity matching model chain B : 0.60

3D Compatibility (PKB) : 10.45
2D Compatibility (Sec. Struct. Predict.) : 0.27
1D Compatibility (Hydrophobicity) : 0.60
QMean score : -0.015

(partial model without unconserved sides chains):
PDB file : Tito_4QMF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4qmf-query.scw
PDB file : Tito_Scwrl_4QMF.pdb: