Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------------RCNVKIYNDKGKYQGQASDDWGETLTIRGYTCYTDSYCKASCDGLPAGWTAEGT-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
3WUW Chain:G ((16-301))KPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSP----VTTAHAGNYT---CRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGGTYRCFGSFRHSPYEWSDPSDPLLV


General information:
TITO was launched using:
RESULT:

Template: 3WUW.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 87 -3202 -36.80 -68.13
target 2D structure prediction score : 0.60
Monomeric hydrophicity matching model chain G : 0.53

3D Compatibility (PKB) : -36.80
2D Compatibility (Sec. Struct. Predict.) : 0.60
1D Compatibility (Hydrophobicity) : 0.53
QMean score : 0.152

(partial model without unconserved sides chains):
PDB file : Tito_3WUW.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3wuw-query.scw
PDB file : Tito_Scwrl_3WUW.pdb: