Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------IFKKPVPTSCKLALTNGNKREVDAKLLPPSGTTILSDTSGAGIFTAKVNSKCEFTSVSPALP-------TGFNIEGSV--------------------------------------------------------------- 2AAK Chain:? ((1-150)) MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDT-----PWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWT

General information: TITO was launched using: RESULT: Template: 2AAK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 184 13576 73.78 205.69 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : 73.78 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.417

(partial model without unconserved sides chains): PDB file : Tito_2AAK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2aak-query.scw PDB file : Tito_Scwrl_2AAK.pdb: