Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence PPSATEKCAYTIYRVASKNGLKALVREGDYIAYKNWDQEIHGVQVHFDG-ECNPKYKSDVYVF 5TVO Chain:B ((1-59)) SFEGPEKRLEVIMRVVDGTHVSGLLAHD----DDVWQKVIDAICAHIVSREFNEYIRSYVLSE

General information: TITO was launched using: RESULT: Template: 5TVO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 98 -13097 -133.64 -225.81 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain B : 0.69 3D Compatibility (PKB) : -133.64 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.097

(partial model without unconserved sides chains): PDB file : Tito_5TVO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5tvo-query.scw PDB file : Tito_Scwrl_5TVO.pdb: