Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------GLKDCQVS------LTAT-SEARRSF-W--DTQYADYNDDVEISA--GRHKFVIH-VE---QG---C--GGSKVSGTIPPHHL 1TIU Chain:? ((1-89)) LIEVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKEL

General information: TITO was launched using: RESULT: Template: 1TIU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 172 8017 46.61 129.30 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : 46.61 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.324

(partial model without unconserved sides chains): PDB file : Tito_1TIU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1tiu-query.scw PDB file : Tito_Scwrl_1TIU.pdb: