Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -HECFTTIHAKTP----------FRSSYSPEYYKASLLQMRPG------EDYYFKNPSPFEGCLVKFDEECTQLIWERLFDFP 3FBL Chain:A ((1-82)) YHKLRLAIKEICKTDGIPNIKWGMYIAFGEKLLKSYLKMKAGSASSDMIAEYINNAISAFSSR-TGISQETAQKIADFITSNY

General information: TITO was launched using: RESULT: Template: 3FBL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 114 -56 -0.49 -0.85 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -0.49 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.228

(partial model without unconserved sides chains): PDB file : Tito_3FBL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3fbl-query.scw PDB file : Tito_Scwrl_3FBL.pdb: