Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------------------RPCRVDLYEFVHTKPGLTSWSWVHRFNGDARRASLFRAMGYLCSVDYNCKNFH---CEKLTSWRW---------------------------------------------------------------------------------------------
1PBV Chain:? ((52-246))ANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGL-NKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIP


General information:
TITO was launched using:
RESULT:

Template: 1PBV.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 138 -519 -3.76 -8.51
target 2D structure prediction score : 0.72
Monomeric hydrophicity matching model chain A : 0.58

3D Compatibility (PKB) : -3.76
2D Compatibility (Sec. Struct. Predict.) : 0.72
1D Compatibility (Hydrophobicity) : 0.58
QMean score : 0.153

(partial model without unconserved sides chains):
PDB file : Tito_1PBV.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1pbv-query.scw
PDB file : Tito_Scwrl_1PBV.pdb: