Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WD-SPVTH------REH------RPAPSPPQRCKVEFGRANKPIGQAIEYWDRD---FIIQG------YTFHCYADCTLKGDYNFPRNQGYWVTS--- 1J8K Chain:A ((1-94)) -NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVA---LHDDMESQPLIGTQSTAIPA

General information: TITO was launched using: RESULT: Template: 1J8K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 210 12651 60.24 183.35 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : 60.24 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.204

(partial model without unconserved sides chains): PDB file : Tito_1J8K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1j8k-query.scw PDB file : Tito_Scwrl_1J8K.pdb: