Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------GECIVKL-HDPNGKVVSWFIALAGKR-EVKKEAAFSWSCSTNSETCEAE---IPLCIVPKNFKPVGEH
4G7X Chain:A ((3-94))INCDPNTTTSHQLLFGFGSPIVQSVLFDGCMLDIEKDDYGFVWSCLSNENGDYCKGLYKPRFTQGVSPNWPMCDLSGASAERCIYP--YCPEGE-


General information:
TITO was launched using:
RESULT:

Template: 4G7X.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 203 8949 44.08 149.15
target 2D structure prediction score : 0.67
Monomeric hydrophicity matching model chain A : 0.63

3D Compatibility (PKB) : 44.08
2D Compatibility (Sec. Struct. Predict.) : 0.67
1D Compatibility (Hydrophobicity) : 0.63
QMean score : 0.159

(partial model without unconserved sides chains):
PDB file : Tito_4G7X.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4g7x-query.scw
PDB file : Tito_Scwrl_4G7X.pdb: