Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence LKRVVICEVFIRMSGGLDLPIGKDFVPA---GETTKIHAYTCETDTMCGAECDTPSNYRYSS 1ZU1 Chain:A ((8-49)) --------------DALDLPVGKDAVNSLIRENSHIFSDTQCK---VCSAVLISESQKL---

General information: TITO was launched using: RESULT: Template: 1ZU1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 60 782 13.03 20.04 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : 13.03 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.428

(partial model without unconserved sides chains): PDB file : Tito_1ZU1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1zu1-query.scw PDB file : Tito_Scwrl_1ZU1.pdb: