Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence EQDCYYTVWTSNGNSWLRSIRDKTRSDHTLGIHGASVYFDEDCYPHYHSKE-------------- 4YN3 Chain:B ((15-96)) DGKNIYIVYMGRKLEGSTFAPESVLHTYKRSFNGFAVKLTEEEAEKIASMEGVVSVFLNEMNELH

General information: TITO was launched using: RESULT: Template: 4YN3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 159 -15253 -95.93 -299.07 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain B : 0.61 3D Compatibility (PKB) : -95.93 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.215

(partial model without unconserved sides chains): PDB file : Tito_4YN3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4yn3-query.scw PDB file : Tito_Scwrl_4YN3.pdb: