Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----EVRPITDFRLNAFNKRVPGCEFGIFYKLL---------DDGGTLIGTQVERVGRSKYSWKFVPYEFAGCK---WDKECNPIDKK-- 3EUJ Chain:B ((63-152)) DVQTQIVTAIQAELAHFRNTAQPINLGAVLQEQLARYPQSRHFDVARIIVDQAVKLGMASQDHQAVYPVWQPIDDFSAAVQAHLIDQYDK

General information: TITO was launched using: RESULT: Template: 3EUJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 167 -1421 -8.51 -19.74 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain B : 0.67 3D Compatibility (PKB) : -8.51 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.111

(partial model without unconserved sides chains): PDB file : Tito_3EUJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3euj-query.scw PDB file : Tito_Scwrl_3EUJ.pdb: