Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------------------------------------------------HFCEVSVSYENANKQKITTATKYVVPPGSVDIAVGSQM-YAVTVDETCKRTDSISIPGR-FKIDTQGK-------------------------------------------------------------------------------------------------------------------- 4HG2 Chain:A ((20-254)) AFRPRYPRALFRWLGEVAPARGDALDCGCGSGQASLGLAEFFERVHAVDPGEAQIRQALRHPRVTYAVAP------AEDTGLPPASVDVAIAAQAMHWFDLDRFWAELRRVARPGAVFAAVTYGLTRVDPEVDAVVDRLYHGLLARDWPPERVHVESGYRTLPFPFPELEAPPLEIEERWPMDAFLGYLGTWSAVTAHRRRTGADPLAEIAPALRAAWGTPERPLRVTWPIAIRAGRILPH

General information: TITO was launched using: RESULT: Template: 4HG2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 189 -3117 -16.49 -51.94 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -16.49 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.188

(partial model without unconserved sides chains): PDB file : Tito_4HG2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4hg2-query.scw PDB file : Tito_Scwrl_4HG2.pdb: