Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------EPNPVVYDAPGSSVQECFWFMFYNGQRVDAGACHSDWSFGLQVGKRFVQIKTDKKCNLHGTYAPGWIVLGRER---
5A6W Chain:C ((11-93))RAIDLSRERDPNFFDHPGIPVPECFWFMFKNNVRQDAGTCYSSWKMDMKVGPNWVHIKSDDNCNLSGDFPPGWIVLGKKRPGF


General information:
TITO was launched using:
RESULT:

Template: 5A6W.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 242 19040 78.68 260.82
target 2D structure prediction score : 0.48
Monomeric hydrophicity matching model chain C : 0.81

3D Compatibility (PKB) : 78.68
2D Compatibility (Sec. Struct. Predict.) : 0.48
1D Compatibility (Hydrophobicity) : 0.81
QMean score : 0.611

(partial model without unconserved sides chains):
PDB file : Tito_5A6W.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5a6w-query.scw
PDB file : Tito_Scwrl_5A6W.pdb: